Welcome to Crystal Creations
EUR Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Categories
Cart
0
Product Details
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone

Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone

Product Code: NH10095469
Product Condition: New
weight: 0.125g
30,80 € inc. tax
 Add to Cart
Description
Luxury Jewelry Set Wholesale Elegant Bridal Wedding Prom Red Crystal Statement Earrings Rhinestone Choker Necklace for Women
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i